PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01140.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24315.6 Da    PI: 7.4213
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01140.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.1e-264291251
                                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    rie+ + rqvtfskRr g+lKKA+ELSvLCdaev +i+fs++ +ly ++s
  Zmw_sc01140.1.g00140.1.sm.mkhc 42 RIEDATSRQVTFSKRRSGLLKKAFELSVLCDAEVGLIVFSPRSRLYQFPS 91
                                    8***********************************************96 PP

2K-box27.11.7e-101321761457
                           K-box  14 aeslqqelakLkkeienLqreqR.hllGedLesLslkeLqqLeqq 57 
                                      e+++ e++ L+k+i++ +  +R +llGe+L+s+s++eLq+Le++
  Zmw_sc01140.1.g00140.1.sm.mkhc 132 IERWKWEATTLEKKIDEVEAHKRwKLLGEGLGSCSIQELQELEER 176
                                     5899***************666659******************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.7543393IPR002100Transcription factor, MADS-box
SMARTSM004326.8E-323392IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-263555IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-253592IPR002100Transcription factor, MADS-box
PfamPF003196.7E-254289IPR002100Transcription factor, MADS-box
CDDcd002651.17E-3143119No hitNo description
PRINTSPR004041.6E-265570IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-267091IPR002100Transcription factor, MADS-box
PfamPF014861.5E-8133175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MVATAAMAAE VAPSPEGGDQ IVAEAPDGRK KLGRRGRREM RRIEDATSRQ VTFSKRRSGL  60
LKKAFELSVL CDAEVGLIVF SPRSRLYQFP SAIESVLDSD TYVSSTLKTI DRYLNHTKGT  120
NVNLKVDDLP GIERWKWEAT TLEKKIDEVE AHKRWKLLGE GLGSCSIQEL QELEERNLWK  180
ENEMLRDQAR SSSVLELNGR ARTGQVVVET EWAIGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-162892159Myocyte-specific enhancer factor 2A
3kov_B2e-162892159Myocyte-specific enhancer factor 2A
3kov_I2e-162892159Myocyte-specific enhancer factor 2A
3kov_J2e-162892159Myocyte-specific enhancer factor 2A
3p57_A2e-162892159Myocyte-specific enhancer factor 2A
3p57_B2e-162892159Myocyte-specific enhancer factor 2A
3p57_C2e-162892159Myocyte-specific enhancer factor 2A
3p57_D2e-162892159Myocyte-specific enhancer factor 2A
3p57_I2e-162892159Myocyte-specific enhancer factor 2A
3p57_J2e-162892159Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701695.11e-54PREDICTED: MADS-box protein SOC1-like isoform X2
SwissprotO646451e-46SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A0D9VB432e-51A0A0D9VB43_9ORYZ; Uncharacterized protein
TrEMBLK3Z0C23e-51K3Z0C2_SETIT; Uncharacterized protein
STRINGSi019985m8e-51(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379